Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_18433
Common NameKK1_018972
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family HD-ZIP
Protein Properties Length: 757aa    MW: 83006.9 Da    PI: 6.509
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_18433genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    +++ +++t++q++eLe+lF+++++p++++r eL+++l+L++rqVk+WFqNrR+++k
                    688999***********************************************999 PP

          START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                    ela++a++elvk+a+ +ep+W +s     e++n +e+++++++  +     + +ea+r +g+v+ ++  lve+l+d++ +W+e+++    + +t e
                    57899************************************999989***9***************************.***************** PP

          START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdl 172
                    vissg      galqlm aelq+lsplvp R++ f+R+++q+ +g w++vdvS+d  ++ +  + +v +++lpSg+++++++ng+skvtwveh+++
                    ***********************************************************999********************************** PP

          START 173 kgrlphwllrslvksglaegaktwvatlqrqcek 206
                    +++++h+l+r+l++sg+ +ga++wvatlqrqce+
                    ********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.605118178IPR001356Homeobox domain
SMARTSM003894.1E-19119182IPR001356Homeobox domain
CDDcd000861.20E-18120178No hitNo description
PfamPF000461.7E-18121176IPR001356Homeobox domain
PROSITE patternPS000270153176IPR017970Homeobox, conserved site
PROSITE profilePS5084844.672280516IPR002913START domain
SuperFamilySSF559611.32E-34283513No hitNo description
CDDcd088752.05E-126284512No hitNo description
SMARTSM002347.9E-47289513IPR002913START domain
PfamPF018529.6E-56289513IPR002913START domain
SuperFamilySSF559613.52E-20535744No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 757 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311660.0KT031166.1 Glycine max clone HN_CCL_121 homeodomain/HOMEOBOX transcription factor (Glyma09g40130.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014490274.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
RefseqXP_014490275.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A151TBG80.0A0A151TBG8_CAJCA; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
STRINGGLYMA09G40130.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein